PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_6EA1E372F.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 306aa    MW: 33241.7 Da    PI: 6.5778
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_6EA1E372F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.49.9e-11180222850
                            HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                            +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Traes_2AS_6EA1E372F.1 180 KRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 222
                            78889*****************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.0E-12173237IPR004827Basic-leucine zipper domain
PfamPF077166.8E-10175222IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.335175231IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-11177231No hitNo description
CDDcd147033.04E-23179228No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-13179231No hitNo description
PROSITE patternPS000360180195IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MAQLPPKIPT MAPAWPEFGG GHHHSAHARH NHHQRSPSTG ASLAESMPPL PPPVPASGDG  60
AQQQPSWVDE FLDFSAAKRG AHRRTVSDSI AFLDDSNAAI GENELDRLDD NQLMSIFSDE  120
LAPQRQAQAA SASSPSDHNS INDGKQDKGD TEEAQSECNG DGAAPGQLSS PATVDPKWVK  180
RILANRQSAQ RSRVRKLQYI SELERSVTSL QTEVSALSPR VAFLDHQRSL LTLGNSHLKQ  240
RIAALARDKI FKDAHQEALK KEIERLRQIY QQQSLRNVEP PAHDDGPLAR SDNNGLIAGE  300
GTAAPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-178HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694867.11e-133PREDICTED: basic leucine zipper 2-like
SwissprotQ5QNI51e-107BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLW5B2780.0W5B278_WHEAT; Uncharacterized protein
STRINGMLOC_72368.41e-159(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.17e-90bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]